PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do015368.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NF-YC
Protein Properties Length: 333aa    MW: 36188.2 Da    PI: 4.5491
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do015368.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC56.56.2e-186861898
       NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                ++++P  rikki++adedv +i+  +Pvl+ska elf+ +l  r++  + ++  +t+  s ++++++  +++dfl ++v +
  Do015368.1  6 DTRFPAPRIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYDITIQKGVKTVGSSHLKQCIQTYNVYDFLREVVSK 86
                5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.3E-24372IPR009072Histone-fold
SuperFamilySSF471137.29E-19488IPR009072Histone-fold
PfamPF008088.0E-17871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MRKKLDTRFP APRIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YDITIQKGVK  60
TVGSSHLKQC IQTYNVYDFL REVVSKVPDP GTSDAIADDK LGKRRKAEED GSEDELKRTR  120
NEAENHTSNG RGRGRGRGRG RRGGRVAWRE VVTTHEQFME NQSSKPASHE QFMENQSSKP  180
AGLKVEIADE VSDATEAKEA TPVSSARASF RNIDLNLDPV DEDDDDEDNE VTVPPQAQLS  240
APATSSVAAN LGLTAPATSS ATANLGLTAP ATSGSAAAAA GPSVLLSMEG AKLKDFLGGW  300
ELPDMNKMDM DPVQFALSLE PRLDEDEDYD NED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A9e-22272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130139RGRGRGRGRG
2130140RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0554820.0BT055482.1 Zea mays full-length cDNA clone ZM_BFb0340H19 mRNA, complete cds.
GenBankEU9676160.0EU967616.1 Zea mays clone 304857 dr1-associated corepressor mRNA, complete cds.
GenBankJX4285130.0JX428513.1 Zea mays subsp. mays clone pUT3111 CA5P10 CCAAT-HAP5 type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961646.11e-165PREDICTED: dr1-associated corepressor-like isoform X2
TrEMBLK3Z8501e-165K3Z850_SETIT; Uncharacterized protein
STRINGSi022720m1e-165(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21723679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-53nuclear factor Y, subunit C11